PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G034000.3
Common NameB456_007G034000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 309aa    MW: 33708.5 Da    PI: 8.4854
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G034000.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.6e-14103147347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  Gorai.007G034000.3 103 PWTEEEHKLFLVGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 147
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.196152IPR017930Myb domain
SuperFamilySSF466893.51E-1798153IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-1699150IPR006447Myb domain, plants
SMARTSM007172.4E-10100150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-11102147IPR009057Homeodomain-like
CDDcd001672.06E-9103148No hitNo description
PfamPF002491.1E-11103147IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGMPPATCAS ASSSSIVNSS PIGGGGGGGG EIMLFGVRVV VDSMRKSVSM NNLSQYEQPH  60
ESNKNNNKND KDQGDDNLTA GYASADDAVP HSTGNRERKR GVPWTEEEHK LFLVGLQKVG  120
KGDWRGISRN FVKTRTPTQV ASHAQKYFLR RSNLNRRRRR SSLFDITTDT AIPMEEERVD  180
RQENSTQPSE TNVFPIMPAT FPMAFNQVVP PVPIQNPTEN LTIAQGNQLN NNVPTANLIR  240
PVPNFPALQR SDLNTDLNPV TDPLSLSLKL SLQSDQMDSS SSSTSRHSPF QVMPNFSSGD  300
NNNIISVA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.10110.0flower|seedling| flowering
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO487437220.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00631PBMTransfer from PK23829.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5250164e-79HQ525016.1 Gossypium herbaceum clone NBRI_E_415 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488869.11e-171PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B07e-76MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A0D2S6750.0A0A0D2S675_G
STRINGGLYMA05G01640.18e-84(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.12e-62MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]